Purchase gigpad.com today. Starter logo included. Money back guarantee. Fast domain transfer.

4.80 Rating by CuteStat

gigpad.com is 2 decades 4 years old. It is a domain having com extension. It has a global traffic rank of #5915400 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, gigpad.com is SAFE to browse.

PageSpeed Score
92
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 142
Daily Pageviews: 284

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 2,070
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 5,915,400
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

13.56.33.8

Hosted Country:

United States of America US

Location Latitude:

37.1835

Location Longitude:

-121.7714

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 8 Total Images: 5
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 13.56.33.8)

The domain name bloxxy.com is for sale

- bloxxy.com

Purchase bloxxy.com today. Starter logo included. Money back guarantee. Fast domain transfer.

Not Applicable $ 8.95

The domain name sparkstack.com is for sale

- sparkstack.com

Purchase sparkstack.com today. Starter logo included. Money back guarantee. Fast domain transfer.

Not Applicable $ 8.95

The domain name sportena.com is for sale

- sportena.com

Purchase sportena.com today. Starter logo included. Money back guarantee. Fast domain transfer.

Not Applicable $ 8.95

The domain name accountvip.com is for sale

- accountvip.com

Purchase accountvip.com today. Starter logo included. Money back guarantee. Fast domain transfer.

Not Applicable $ 8.95

The domain name fotoxo.com is for sale

- fotoxo.com

Purchase fotoxo.com today. Starter logo included. Money back guarantee. Fast domain transfer.

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: openresty/1.15.8.2
Date: Thu, 26 Dec 2019 13:10:46 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Domain: www.gigpad.com
PType: cache only
Theme file: static__/_theme_file.var.html
BrandBucket-domain: gigpad.com #146012
X-Frame-Options: sameorigin
Content-Encoding: gzip

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: Nov 29, 1999, 10:01 PM 2 decades 4 years 5 months ago
Expiration Date: Nov 29, 2020, 10:01 PM 3 years 5 months 2 weeks ago
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
ns1.brandbucket.com 54.241.53.41 United States of America United States of America
ns2.brandbucket.com 18.221.52.246 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
gigpad.com A 3600 IP: 13.56.33.8
gigpad.com NS 3600 Target: ns2.brandbucket.com
gigpad.com NS 3600 Target: ns1.brandbucket.com
gigpad.com SOA 9016 MNAME: ns1.brandbucket.com
RNAME: admin.gigpad.com
Serial: 2018090201
Refresh: 14400
Retry: 14400
Expire: 604800
Minimum TTL: 64800
gigpad.com TXT 3600 TXT: 27aab5373841b85aab94982ee19ab62f96481ed6

Similarly Ranked Websites


New Westminster Family Practice

- newwestminsterfamilypractice.ca
5,915,407 $ 240.00

Domain Default page

- tenisdemesa.com.br
5,915,408 $ 240.00

Gallery - Smart Real Estate Riders QR Pro

- smartriderpro.com
5,915,409 $ 240.00

Ozzy Furocity Forums

- ozzyfurocity.net

Home of the Ozzy Furocity Team Fortress 2 Servers

5,915,410 $ 240.00

Full WHOIS Lookup

Domain Name: gigpad.com
Registry Domain ID: 14193134_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-10-02T19:49:45Z
Creation Date: 1999-11-29T16:16:58Z
Registrar Registration Expiration Date: 2020-11-29T16:16:58Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: Media Plow, LLC
Registrant State/Province: Nebraska
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=gigpad.com
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=gigpad.com
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=gigpad.com
Name Server: NS1.BRANDBUCKET.COM
Name Server: NS2.BRANDBUCKET.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-26T13:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.